№ files_lp_3_process_7_052915
File format: docx Character count: 6034 File size: 179 KB
Supplementary dataset reporting physicochemical properties of a disulfide compound library and mass spectrometry screening results for binding to the hTS C195S-Y202C protein, including peptide-level identification after trypsin digestion.
Year: Not specified
Type of document: Supplementary scientific data
Subject: Mass spectrometry screening of disulfide compounds
Analyzed protein: hTS C195S-Y202C
Techniques: MALDI MS; ESI-QToF MS; ESI MS; Trypsin digestion
Content: Compound library properties and screening results
Compounds analyzed: A1–A55; TCP
Chemical identifiers: NCI codes; ZINC codes
Measured parameters: Molecular weight (MW); Log P; Number of heavy atoms
Peptide sequences: IIMCAWNPR; RIIMCAWNPR; DLPLMALPPSHALCQFCVVNSELSCQLYQR
Detection criteria: Replacement of carbamidomethylic group (56 Da) with thiol-derived mass from disulphides
Binding sites: Cys 180; Cys 199; Cys 202; Cys 210
Price: 8 / 10 USD
The file will be delivered to the email address provided at checkout within 12 hours.

Don’t have cryptocurrency yet?

You can still complete your purchase in a few minutes:
  1. Buy Crypto in a trusted app (Coinbase, Kraken, Cash App or any similar service).
  2. In the app, tap Send.
  3. Select network, paste our wallet address.
  4. Send the exact amount shown above.
After sending, paste your TXID (transaction ID) and your email to receive the download link. Need help? Contact support and we’ll guide you step by step.

The final amount may vary slightly depending on the payment method.
The file will be sent to the email address provided at checkout within 24 hours.
The product description is provided for reference. Actual content and formatting may differ slightly.
APUSH Exam Review Bootcamp, Day 7: Historical Thinking Skills (HTS): Contextualization
Year: 2023
Region / City: United States
Topic: History, APUSH Exam
Document Type: Educational Resource
Institution: APUSH Bootcamp
Author: Unknown
Target Audience: APUSH Students
Date of Approval: 2023
Period of Application: May 11, 2023 (APUSH Exam Date)
Date of Changes: N/A
Topics: 3A–3C C195S-Y202C hTS